Protein Info for GFF3620 in Sphingobium sp. HT1-2

Annotation: putative TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 40 to 63 (24 residues), see Phobius details PF03544: TonB_C" amino acids 175 to 250 (76 residues), 43.7 bits, see alignment E=3.1e-15 TIGR01352: TonB family C-terminal domain" amino acids 176 to 251 (76 residues), 60.1 bits, see alignment E=1.1e-20 PF13103: TonB_2" amino acids 191 to 238 (48 residues), 31.9 bits, see alignment 1.2e-11

Best Hits

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF3620 putative TonB-dependent receptor (Sphingobium sp. HT1-2)
MASLPLARAPLTVRAPSHVEPVWAYSRYSDQAMQLRTRMAGMGGVGAIGMAALAVSFVTW
HTYVAPKSTPTLSIFAVAPPAAPPEPAREVPPGPEQVQKEKSQPTPQQPMLEPPKIIVPS
ANILPAVAARPVPDPGPPIKDTTAPESKPAPPAPQISTDKPTWEGLVLGALNKVKHYPRD
AHFARQQGVPYIRFVMDRDGKLLSARIERSSGVRSLDQEALALPKRAQPLPKPPEDVKGD
SIELVVPVEFFLR