Protein Info for GFF362 in Xanthobacter sp. DMC5

Annotation: Bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00754: bacterioferritin" amino acids 1 to 156 (156 residues), 216 bits, see alignment E=1.4e-68 PF00210: Ferritin" amino acids 8 to 142 (135 residues), 118 bits, see alignment E=3.3e-38

Best Hits

Swiss-Prot: 63% identical to BFR_BRUSU: Bacterioferritin (bfr) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03594, bacterioferritin (inferred from 96% identity to xau:Xaut_3765)

MetaCyc: 58% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"bacterioferritin"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF362 Bacterioferritin (Xanthobacter sp. DMC5)
MKGDPKVIEYLNRGLRSELTAINQYWLHYRMLDNWGYKALAKKWRAESIEEMVHADKFTD
RILFLDGFPNMQVLDPLRIGQDVKEILDCDLAAELDARALYQEAATYCHSVKDYPSRDLF
EELMADEEGHIDFLETQLDLVSKLGLQLYAQHHIGEMDED