Protein Info for GFF3614 in Variovorax sp. SCN45

Annotation: UPF0056 inner membrane protein YchE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 114 to 141 (28 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details PF01914: MarC" amino acids 7 to 209 (203 residues), 169.2 bits, see alignment E=3.9e-54 TIGR00427: membrane protein, MarC family" amino acids 8 to 206 (199 residues), 166.6 bits, see alignment E=3e-53

Best Hits

Swiss-Prot: 37% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 97% identity to vpe:Varpa_5613)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>GFF3614 UPF0056 inner membrane protein YchE (Variovorax sp. SCN45)
MSTSMDLIKPLVTLVAIVNPLAIVPFFIHYTQGYTDAQRRHTVRMSAFSAFVVIAVSALI
GLQLLSFFGISIASFQVGGGLLLLMSSLSMLNAKPAESKTNVEELRATEVKASMGASIAV
VPLTIPLLTGPAAISTVVIYADKAQHLWELAILVGYGVVVALATALAFSLAQPIARVLGK
TGINIMTRLMGLILAALAVEVMADGLGKLFPILNKLA