Protein Info for GFF361 in Sphingobium sp. HT1-2

Annotation: ParA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13614: AAA_31" amino acids 3 to 158 (156 residues), 102.6 bits, see alignment E=6.3e-33 PF10609: ParA" amino acids 3 to 140 (138 residues), 39.4 bits, see alignment E=1.2e-13 PF06564: CBP_BcsQ" amino acids 3 to 146 (144 residues), 29.4 bits, see alignment E=1.5e-10 PF01656: CbiA" amino acids 4 to 124 (121 residues), 42.5 bits, see alignment E=1.6e-14 PF09140: MipZ" amino acids 6 to 149 (144 residues), 22.8 bits, see alignment E=1.3e-08

Best Hits

KEGG orthology group: None (inferred from 88% identity to sjp:SJA_C1-33320)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF361 ParA-like protein (Sphingobium sp. HT1-2)
LATIAVYSLKGGVGKTTFSVNLAWASASISKRRTLLWDIDPQAASSWLLSTDLESRDAAQ
AIFSKDVEVRKLIQPTTVPGLDLIAADTSLRSLDHLFREMDKKKRLAKLIDSLGKDYDRI
ILDCPPGLTETSEQVLRAADLIVIPVIPSPLSQRAMGEVARYLVQRGGNHAPILPVYSMV
DRRRSLHRKALEEQPGWGAIPMASTIEQMTVRRKPLGAFAPASPPAQAFGALWTMVERQV
QQG