Protein Info for PS417_18465 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 169 to 190 (22 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 7 to 462 (456 residues), 421.4 bits, see alignment E=2.4e-130 PF00672: HAMP" amino acids 188 to 240 (53 residues), 34.2 bits, see alignment 5.3e-12 PF26769: HAMP_PhoQ" amino acids 194 to 240 (47 residues), 32.1 bits, see alignment 1.9e-11 PF00512: HisKA" amino acids 246 to 309 (64 residues), 45.4 bits, see alignment E=1.4e-15 PF02518: HATPase_c" amino acids 356 to 464 (109 residues), 78.8 bits, see alignment E=8.8e-26

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 95% identity to pfs:PFLU4172)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1V0A4 at UniProt or InterPro

Protein Sequence (466 amino acids)

>PS417_18465 histidine kinase (Pseudomonas simiae WCS417)
MNTRRHYSLTLRLALIFALLAFALLATLGVALYRELERELIMRDDAALIYRIDQLRNLLN
DSNTLDLIKTKPELFQNMLGNRESALSIAAPGQQPLLTVNPGNINLPSVPPVPKNHKLTF
ADVHHFPGINGVPFATVAASIDSGDLGSLQVTTGRLMTERTAVLASYRLSVYVLASIAAI
ILAVVGYLLVHRGLLPLRRLARHAQGIGVGNLAERLDSHGAPKELLPMIDSFNTMLERLA
KGFVQLGQVSTDMAHELRTPINNLLGETQVALQQNRSIESYQQLLASNVEELERLARMLD
NMLFLARTDPASALRQRQELNAADEVERIAEYFEGLAGDVDISIHAEGDGVIWAEPMLLR
RALANLCANAIKYGAPGTVLQIRAVPSAEGIHLRVSNRGETIAAEHLPQLFERFYRVDES
RERSAQSNGLGLSIVATIMQLHNGRYDVSSEAGVTCFELFFPKRED