Protein Info for GFF3607 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 226 to 258 (33 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 275 (269 residues), 114.7 bits, see alignment E=2.3e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 97% identity to vpe:Varpa_5620)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF3607 ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MQILQLLLSGIAQGCIYGLIALGFVLIYKATETVSFAQGDLMMLGAFGAFAGMSLFGMPF
WLAAILAVVAMAAFGVLLELVVIRSILGQPQFSIVMLTIGIAYVARGVITMVPGIGTETH
TLAVPYKDQIWKLGELVVNLEQLAIIIATAVLCGLLFAMFRYSKLGIAMQASSQNQLAAY
YMGIPVKRLNGLVWGLAAAVAAIAGMLLAPITFVHANMGFIGLKAFPAAVVGGFGSLPGA
IVGGLVIGIVESFAGFYLPDGFKDTAPYIVVLLMLMIKPNGLFGEKLRKKV