Protein Info for GFF3606 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion spans bacterial envelope protein (YscO)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF28280: SsaO" amino acids 1 to 122 (122 residues), 255.9 bits, see alignment E=3.5e-81

Best Hits

Swiss-Prot: 100% identical to SSAO_SALTY: Secretion system apparatus protein SsaO (ssaO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to sty:STY1704)

Predicted SEED Role

"Type III secretion spans bacterial envelope protein (YscO)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>GFF3606 Type III secretion spans bacterial envelope protein (YscO) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LLEIIARREKQLRGKLTVLDQQQQAIITEQQICQTRALAVSTRLKELMGWQGTLSCHLLL
DKKQQMAGLFTQAQSFLTQRQQLENQYQQLVSRRSELQKNFNALMKKKEKITMVLSDAYY
QS