Protein Info for PS417_18430 in Pseudomonas simiae WCS417

Annotation: carbon storage regulator CsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 64 TIGR00202: carbon storage regulator" amino acids 1 to 53 (53 residues), 96.1 bits, see alignment E=5.3e-32 PF02599: CsrA" amino acids 1 to 52 (52 residues), 97.3 bits, see alignment E=1.9e-32

Best Hits

Swiss-Prot: 97% identical to CSRA1_PSEPH: Translational regulator CsrA1 (csrA1) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: K03563, carbon storage regulator (inferred from 97% identity to pfo:Pfl01_1912)

Predicted SEED Role

"Carbon storage regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U981 at UniProt or InterPro

Protein Sequence (64 amino acids)

>PS417_18430 carbon storage regulator CsrA (Pseudomonas simiae WCS417)
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDK
NQTP