Protein Info for GFF3600 in Sphingobium sp. HT1-2

Annotation: Tyrosyl-tRNA synthetase (EC 6.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR00234: tyrosine--tRNA ligase" amino acids 6 to 390 (385 residues), 363.5 bits, see alignment E=7.7e-113 PF00579: tRNA-synt_1b" amino acids 39 to 328 (290 residues), 261.1 bits, see alignment E=2e-81 PF22421: SYY_C-terminal" amino acids 334 to 393 (60 residues), 27.9 bits, see alignment E=2.6e-10 PF01479: S4" amino acids 355 to 392 (38 residues), 27.7 bits, see alignment 2.7e-10

Best Hits

Swiss-Prot: 70% identical to SYY_NOVAD: Tyrosine--tRNA ligase (tyrS) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 93% identity to sch:Sphch_0526)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>GFF3600 Tyrosyl-tRNA synthetase (EC 6.1.1.1) (Sphingobium sp. HT1-2)
MSNYQSDLLRLLEARGYIHQLTDAEGLDAMAAKQVVPGYIGFDPTAPSLHVGHLVSIMML
RQLQKAGHKPIVLMGGGTGKIGDPSFKDEARKLLTVDLIQENVASIKRVFERFLTFGDGP
TDAIMVDNADWLDKLEYIPFLRDIGQHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQ
AYDFLELSRRSDCRLQMGGSDQWGNIVNGVELARRVDGTQVFGLTTPLLTNADGTKMGKT
VGGAVWLNQDQLSDYDYWQFWRNTADADVFNRLRLFTDLPMDEVNRLAALQGAEINEAKK
ILANEATALCRGVEAAALAAETARKTFEEGASDANLPTVALGAEGLTVIQATTGLGFATS
NKEVRRKLAEGAIKVNGEVVTDPAATLKAGDKLSFGAKKHGLVTA