Protein Info for GFF3596 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 253 to 257 (5 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 72% identity to sch:Sphch_1285)

Predicted SEED Role

"FIG01096308: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF3596 hypothetical protein (Sphingobium sp. HT1-2)
MTFAAILSASRASSDSPAALRATLHFAGQTLVEYQARQAVRAGADRIMILVSVITPAISQ
AVDRLSADGIAVALIRDMVSMVRDAPRDADVLLVADGAVVAQGHYDALAGQAGNALLVTD
DSRASAPFERIDAGQRWAGLARINPALLFGTLDMIGDWDLALTLVRSAVQGGAVRITVPQ
DDLLEGRVALVDGQEQADLAAQAVMSTGTRSGSSSRGGIEHYLFGPLARLLGPALMRSQV
PAMQVRIGSIALAGIALMPLELGWPGTGISLLLLALLLAELADRLDEMALRRPPSGWIAF
LAPGLTLIGVMLSGSGMVPNYLALLLGIITVADRWRRTGAARPWMIFTPGTALLVLLAAL
LTGAEAFGFDVAMLAAIGSIGAIILSRRGG