Protein Info for PS417_18405 in Pseudomonas simiae WCS417

Updated annotation (from data): D-ribose ABC transporter, substrate-binding component RbsB
Rationale: No fitness data for this gene, but data for PS417_18400:18395 confirm this is the ABC transporter for ribose.
Original annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 35 to 295 (261 residues), 86.8 bits, see alignment E=2.9e-28 PF13407: Peripla_BP_4" amino acids 37 to 300 (264 residues), 203.7 bits, see alignment E=5.7e-64 PF13377: Peripla_BP_3" amino acids 172 to 299 (128 residues), 34.9 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU4160)

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEH6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PS417_18405 D-ribose ABC transporter, substrate-binding component RbsB (Pseudomonas simiae WCS417)
MKLPFAGRLLAVAVLAAASAALPLSSAFADDAAKPKVGLVMKSLANEFFVTMQDGAKTYQ
KEHAADFDMITNGIKNETDTSAQIDIVNQMILAKVNAIVIAPADSKALVTVLKKASDAGI
KVVNIDNRLDPDVLKSKNLDIPFVGPDNRKGSKLVGDYLAKQLASGDKVGIIEGVPTTTN
AQQRTAGYKDAMDAAGMKIVSTQSGNWEIDQGQKVASAMLSEYPDLKALLAGNDNMALGA
VSAVRAAGKAGKVLVVGYDNIEAIKPMLQDGRVLATADQAAAQQAVFGIQNALKLVKGEK
VDSKDGVIETPVELVLKK