Protein Info for GFF3591 in Xanthobacter sp. DMC5

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details PF00512: HisKA" amino acids 237 to 306 (70 residues), 75.4 bits, see alignment E=2.9e-25 PF02518: HATPase_c" amino acids 353 to 462 (110 residues), 104.4 bits, see alignment E=4.7e-34

Best Hits

KEGG orthology group: K11357, two-component system, cell cycle sensor histidine kinase DivJ [EC: 2.7.13.3] (inferred from 73% identity to xau:Xaut_1406)

Predicted SEED Role

"Two component system histidine kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>GFF3591 Sensor histidine kinase RcsC (Xanthobacter sp. DMC5)
VAHVFGDAAAGARPVPARDGGDREALPRLAGLGRLTGAVLSGLGLLGLGSGGLVLLAEFS
GLATGGLLNATTLLASGFVCAALAAVAGGLARAATKASAAPPSDMLLVTCHGPRGEVVRV
ERQGGPFAASPASALEGMALFERVLVADRPAFLSAVEAASRGRAATLELRLRCDTAGDGA
PSFLTAEARCRAMRGGMVRVSWRAPWQQAQTEQMKAERQKADAAARARAEAEAANAAKSR
FLAAMSHELRTPLNAILGFSELLATQTGAPLDDARKADYARIIHESGQHLLGLVNDILDL
SRVEAGAYVLEREAVDVGALVAGCAEMVALDAERTGVSVKTKVPARLPVLDADKRALRQI
VLNLLSNAVKFTPAGGRVQVGVRMQGDELIIRVRDTGPGMRPEDVARLGEPFFQAGDCIQ
KSRGSGLGIAVVKGLVKLHDGDVRVESALGRGTSVSVSLPVAAAIEAKGQGQGVVAPFPA
RTEDTRAKRTA