Protein Info for PS417_18380 in Pseudomonas simiae WCS417

Annotation: ribose pyranase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05025: RbsD_FucU" amino acids 1 to 133 (133 residues), 145 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 94% identical to RBSD_PSEFS: D-ribose pyranase (rbsD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06726, D-ribose pyranase [EC: 5.-.-.-] (inferred from 94% identity to pfs:PFLU4155)

Predicted SEED Role

"Ribose ABC transport system, high affinity permease RbsD (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U970 at UniProt or InterPro

Protein Sequence (134 amino acids)

>PS417_18380 ribose pyranase (Pseudomonas simiae WCS417)
MKKTPLLNIALSRVIASLGHGDILVIGDAGLPVPPGVELIDLALTQGIPDFISTLRIVLS
EMQVESHVLAEEILLKQPPALAELNALTEQTALGERRLVSHEEFKQLSRKARAVVRTGEC
QPYCNIALVSGVTF