Protein Info for GFF3588 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 1, maltose/g3p/polyamine/iron)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 123 to 280 (158 residues), 32.4 bits, see alignment E=3.8e-12

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 79% identity to pol:Bpro_4356)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF3588 ABC transporter, permease protein 2 (cluster 1, maltose/g3p/polyamine/iron) (Variovorax sp. SCN45)
MRSLEFGNRRGMPGTDSSASGKYAGCLPTLEPTLVRGISLIYGLYLLLPIVLLMIGSVGG
NWTNTLLPTGITGQWYVDLWLDTSFRKAFVSSLVVAMSACAINTVLALPLAYALYHGARR
GGSLAARIVSATPVAVPAITLAFGYMIVFNTDLAPWLGSMPLLIAAHAILTLPYLTNTLL
ADLRHLDLGRLEQAAATLGASGWQQFTGIVLPSLRQSLISGLVMVAAISVGEFGVSNLLT
SFQNRTYPVVLLQAFYGATGFACAATVILLVLASASALLSSSLVKQRA