Protein Info for PS417_18340 in Pseudomonas simiae WCS417

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00168: translation initiation factor IF-3
  • amino acids 13 to 176 (164 residues), 217.6 bits, E=3.9e-69
• PF05198: IF3_N
  • amino acids 13 to 78 (66 residues), 107.5 bits, E=3.2e-35
• PF00707: IF3_C
  • amino acids 89 to 174 (86 residues), 122.1 bits, E=7.6e-40

Best Hits

Swiss-Prot: 99% identical to IF3_PSEFS: Translation initiation factor IF-3 (infC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 98% identity to psp:PSPPH_2136)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See A0A1N7UHY1 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PS417_18340 translation initiation factor IF-3 (Pseudomonas simiae WCS417)
MRQDKRAAPKAPINENISAREVRLIGADGEQIGIVSIDEALRIAEESKLDLVEISADAVP
PVCRVMDYGKSIFEKKKQIAAAKKNQKQIQVKEIKFRPGTEEGDYQVKLRNLVRFLSDGD
RAKVSLRFRGREMAHQELGMELLKRVEADLLEYGSVEQHPKMEGRQLIMVIAPKKKK