Protein Info for GFF358 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG074102: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02050: carboxylate-amine ligase, YbdK family
  • amino acids 13 to 298 (286 residues), 312 bits, E=2e-97
• PF04107: GCS2
  • amino acids 15 to 292 (278 residues), 166.8 bits, E=3.6e-53

Best Hits

Swiss-Prot: 66% identical to GCS21_LEGPL: Putative glutamate--cysteine ligase 2-1 (lpl0652) from Legionella pneumophila (strain Lens)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 66% identity to lpf:lpl0652)

MetaCyc: 41% identical to putative glutamate--cysteine ligase 2 (Escherichia coli K-12 substr. MG1655)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"FIG074102: hypothetical protein"

MetaCyc Pathways

• glutathione biosynthesis (2/2 steps found)
• ophthalmate biosynthesis (2/3 steps found)
• γ-glutamyl cycle (4/6 steps found)
• homoglutathione biosynthesis (1/2 steps found)
• ergothioneine biosynthesis I (bacteria) (4/7 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.2

Use Curated BLAST to search for 6.3.-.- or 6.3.2.2

Protein Sequence (375 amino acids)

>GFF358 FIG074102: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPLETFKASDSLTMGVELELQLVNTYDLDLSSSANDLLELLRRKPFPGVVTPEMTQSMIE
IATDVQREHGPLLAQLQQIRDTLVSAGDRLNIELSGGGTHPFQRWFEQRIFSKPRFEQLS
GLYGYLAKQFTVFGQHVHIGCSSADEALFLLHSLNRYVPHFIALSASSPFSQGVDTLFDS
ARLNSVFAFPLSGRAPFVLSWEEFTDVYFTKMESTGVVKSMKDFYWDIRPKPEYGTIELR
VCDTPLTVERAAGLACYLQALCRHLLERRELPPEEDDYLVYTYNRFQACRFGLDGMMVNP
KTREQISIREDILATLRHLTPHGVALNSLAALDEIERTAGRVGNHATFLRNQFKESGSVQ
SVVRASVEALRSARS