Protein Info for GFF3574 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Tetrathionate reductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF12838: Fer4_7" amino acids 52 to 116 (65 residues), 27.2 bits, see alignment E=1.3e-09 amino acids 100 to 146 (47 residues), 28.4 bits, see alignment 5.6e-10 PF13247: Fer4_11" amino acids 94 to 187 (94 residues), 104.4 bits, see alignment E=9.4e-34 PF13237: Fer4_10" amino acids 125 to 178 (54 residues), 24.6 bits, see alignment E=6.1e-09 PF00037: Fer4" amino acids 125 to 146 (22 residues), 29.1 bits, see alignment (E = 1.8e-10)

Best Hits

Swiss-Prot: 100% identical to TTRB_SALTY: Tetrathionate reductase subunit B (ttrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08358, tetrathionate reductase subunit B (inferred from 99% identity to see:SNSL254_A1498)

MetaCyc: 100% identical to tetrathionate reductase beta subunit (Salmonella enterica enterica serovar Typhimurium)
1.21.99.M4 [EC: 1.21.99.M4]

Predicted SEED Role

"Tetrathionate reductase subunit B" in subsystem Tetrathionate respiration

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.99.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>GFF3574 Tetrathionate reductase subunit B (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDSSKRQFLQQLGVLTAGASLVPLAEAKFPFSPERHEGSPRHRYAMLIDLRRCIGCQSCT
VSCTIENQTPQGAFRTTVNQYQVQREGSQEVTNVLLPRLCNHCDNPPCVPVCPVQATFQR
EDGIVVVDNKRCVGCAYCVQACPYDARFINHETQTADKCTFCVHRLEAGLLPACVESCVG
GARIIGDIKDPHSRIATMLHQHRDAIKVLKPENGTSPHVFYLGLDDAFVTPLMGRAQPAL
WQEV