Protein Info for PS417_18295 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 166 to 185 (20 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details PF00672: HAMP" amino acids 183 to 230 (48 residues), 58.6 bits, see alignment 9.6e-20 PF00512: HisKA" amino acids 239 to 300 (62 residues), 48.2 bits, see alignment E=1.4e-16 PF02518: HATPase_c" amino acids 350 to 459 (110 residues), 92.1 bits, see alignment E=4.6e-30

Best Hits

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 96% identity to pfs:PFLU4121)

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ79 at UniProt or InterPro

Protein Sequence (461 amino acids)

>PS417_18295 histidine kinase (Pseudomonas simiae WCS417)
MKFSISTKLFIAVLAGVLLVILSMGLATSWSFGRGFLGYLNEQALERMAPVLPRLASAYA
REGNWEFLRNQPDRWFEIMRPELGADPAKNDLRSPMASDLTGALFRIALLDKYKKRVNGY
PDIGTDALLRPIVVADETVGWLAVTPFQSVTEAGGERFQQYQLRTSLVMGAFSLLLAMLI
AWWIARTLLEPVKRVAAATHRLASGDFSSRVAVSSNDEVGQLARDFNQLAYTLERNEQMR
REFMADVSHELRTPLSVLRGELEAIEDGVRTLDPGSMQSLQGEVSMLSKLVDDLYELSLA
DVGALTYRKSACALEPLLRASVSMFQERLNARHLRLELDLPAPPVELLADAGRLQQLFSN
LLENAVRYTDPNGLIRIRVALDRADVCIDILDSGPGVSAEQLPRLFERFYRGESSRNRAS
GGAGLGLAICHSIALAHGGSLSAAHSPLGGLWLSLRLPRNT