Protein Info for GFF3570 in Variovorax sp. SCN45

Annotation: Organic hydroperoxide resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF22381: Staph_reg_Sar_Rot" amino acids 31 to 112 (82 residues), 70.1 bits, see alignment E=2.7e-23 PF12802: MarR_2" amino acids 41 to 99 (59 residues), 39.5 bits, see alignment E=1.1e-13 PF13463: HTH_27" amino acids 42 to 108 (67 residues), 30.3 bits, see alignment E=8.5e-11 PF01047: MarR" amino acids 42 to 100 (59 residues), 60.5 bits, see alignment E=2.3e-20

Best Hits

Swiss-Prot: 47% identical to OHRR_BACSU: Organic hydroperoxide resistance transcriptional regulator (ohrR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_5649)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>GFF3570 Organic hydroperoxide resistance transcriptional regulator (Variovorax sp. SCN45)
MRSTPVSADEMLKLDNQLCFAVYSASLAMTRLYKPVLEKLQLTYPQYLVMLSLWEHDGPT
VSALGDRLSLDSGTLTPLLKRLEASGYVSRVRDVADERRVHITLTAVGRQLKTRAADVPE
CLMAAAQCSVPELVSLTQQIQTLRDRIRKAA