Protein Info for GFF357 in Sphingobium sp. HT1-2

Annotation: 3-dehydroquinate dehydratase II (EC 4.2.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 119 to 139 (21 residues), see Phobius details TIGR01088: 3-dehydroquinate dehydratase, type II" amino acids 6 to 144 (139 residues), 195.4 bits, see alignment E=1.7e-62 PF01220: DHquinase_II" amino acids 6 to 143 (138 residues), 201.8 bits, see alignment E=1.8e-64

Best Hits

Swiss-Prot: 62% identical to AROQ_CAUVC: 3-dehydroquinate dehydratase (aroQ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 91% identity to sch:Sphch_1677)

MetaCyc: 56% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF357 3-dehydroquinate dehydratase II (EC 4.2.1.10) (Sphingobium sp. HT1-2)
MADTRKIYVLNGPNLNMLGTREPEIYGYDTLDDIAERMEDAAHRAHVEIDFRQSNHEGHL
VDWVQEAHREGAHAIIMNPGAYTHTSIALHDAIKSITVPVIEIHLSNPHAREAFRHKSYV
GMAAKGTIAGFGAMSYMLALEAALEL