Protein Info for GFF3568 in Xanthobacter sp. DMC5

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 44 to 294 (251 residues), 179.7 bits, E=3.4e-56
• PF13489: Methyltransf_23
  • amino acids 152 to 286 (135 residues), 40.2 bits, E=1.1e-13
• PF05175: MTS
  • amino acids 157 to 240 (84 residues), 37.2 bits, E=8.5e-13
• PF01135: PCMT
  • amino acids 159 to 258 (100 residues), 26.3 bits, E=2.1e-09
• PF13847: Methyltransf_31
  • amino acids 160 to 259 (100 residues), 30.8 bits, E=8e-11
• PF13649: Methyltransf_25
  • amino acids 161 to 254 (94 residues), 35.8 bits, E=3.7e-12
• PF08241: Methyltransf_11
  • amino acids 162 to 257 (96 residues), 21.4 bits, E=1.1e-07

Best Hits

Swiss-Prot: 53% identical to PRMA_BRADU: Ribosomal protein L11 methyltransferase (prmA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 85% identity to xau:Xaut_1424)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (303 amino acids)

>GFF3568 Release factor glutamine methyltransferase (Xanthobacter sp. DMC5)
MLEGLPPNDATHVMRVEAPRRQAQRIADLISETFDPAEVAVANFERTDDDWVVEVYAGAA
FDADTLRELVEIAAGPELAATVTFGEIEQKDWVAASLEGLAPVAVGPVVVHGSHDRGRVG
PNRIGIEIEAALAFGTGHHGTTQGCLHAIVNAARRGRPQRVLDVGTGTGVLAIAAERLFH
TEIVGSDIDIIAVRTAKANAAANKAPGVRMVHAAGAGARAIRIHGPYDLILANILLPPLK
RLARPLASLLAPGGRIVLSGLLTAQVPAALAAYRAQGLHLVSQRHIEGWATLTLAARSDR
PRG