Protein Info for GFF3567 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 55 (25 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details PF20973: VUPS" amino acids 17 to 221 (205 residues), 252.3 bits, see alignment E=3.4e-79 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 251 to 413 (163 residues), 147 bits, see alignment E=2.2e-47 PF00990: GGDEF" amino acids 257 to 410 (154 residues), 130.3 bits, see alignment E=6e-42

Best Hits

KEGG orthology group: None (inferred from 70% identity to xau:Xaut_1425)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>GFF3567 hypothetical protein (Xanthobacter sp. DMC5)
MIALNILLLGAEMLVYFGAMLALFRLRGTLGIGVFFCALGSLHFMETYLAAAYYVQLPFS
VSLSPGSVVLFSGKLALLLLVYIREDALVARQPIYGLFLGNLVMLALVFLLRLHDVVPAP
GVPGDIAFMDQLGALAVWSTLLLFIDSIAMILLYERLSSRVKRYPVTVIWATLALVLTFD
QVGFFGVLHFALDVPLSAGIGGWVGKMVAAGFYALMLALYLDRFEMAGDPLRPRIADVFD
TLTYRQRYEQLEVTSRLDPLTGVLHRGQLEPLGRDLVAIARKTGRPMSLLLVDVDDYKEV
NDIHGHATGDAVLRQLAGAISESLRQSDHVVRYGGDEFAVLAPGVSHVSAVTLAHMLNES
VTALALPDGVRKQTLSIGVATLPEDGQTLTALLEAADKRLYAAKAAGRNRVTGAAGDGGL
SDNG