Protein Info for PS417_18255 in Pseudomonas simiae WCS417

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 41 to 401 (361 residues), 220 bits, E=4.8e-69
• PF13193: AMP-binding_C
  • amino acids 450 to 527 (78 residues), 88.3 bits, E=5.3e-29

Best Hits

KEGG orthology group: K01895, acetyl-CoA synthetase [EC: 6.2.1.1] (inferred from 87% identity to pfs:PFLU3213)

Predicted SEED Role

"Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases"

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• chitin deacetylation (2/4 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)
• cis-geranyl-CoA degradation (4/9 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

See A0A1N7U623 at UniProt or InterPro

Protein Sequence (546 amino acids)

>PS417_18255 AMP-binding protein (Pseudomonas simiae WCS417)
MRDYDSAVTSFNYRQLATQDLHGELAAMNACIECCDRHALGDAVALYCETPDGRATHHTF
SELQAHAARFGNFLREQGVKPGERVAGLMPRTVELLIAILGTWRIGAVYQPLFTAFGPKA
IEQRLGCSEARWIVTDAHNRPKLDDVIDCPRIIVTGAGPRNPDDYDFWTVLDRQQADCVP
ELLDASAPFLLMCTSGTTGPAKPLEVPLSAILAFKGYMRDSIDLREDDHFWNLADPGWAY
GLYYAVTGPLACGRATLFYDGPFAVDSTCRIIAKYAITNLAGSPTAYRLLIAAGAAFADT
VRGRLRVISSAGEPLNPQVIRWFADELGVVIHDHYGQTEIGMVLCNHHGLRHPVREGSAG
YAVPGYRIVVLDDAHRELPPGRPGVLAVDRERSPLCWFEGYFGMPTQAFVDRYYLSGDIV
ELNDDGSISFVGRNDDVITTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPQRTELIKAF
VVLNSQSLPSTELAEVLRLHVRQRLAAHAYPREIEFVEHLPKTPSGKLQRFILRNQEIAK
QQAFDT