Protein Info for GFF3559 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 69 to 237 (169 residues), 217 bits, see alignment E=1.6e-68 PF02627: CMD" amino acids 104 to 151 (48 residues), 34.3 bits, see alignment 9.7e-13 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 118 to 154 (37 residues), 40.5 bits, see alignment 1.5e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_1433)

Predicted SEED Role

"Mlr4105 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF3559 hypothetical protein (Xanthobacter sp. DMC5)
MASKVKAAGGVEKAKSATAANKGRPETKAAPSARKSSAKSSVPKPAVPAAEPARQRDDLP
AIALAIPPAELDAQNQAYFDKCAEKIGFVPNVLQAYALDMAKLNAFAGMYNDLMLAPSGL
SKLEREMIAVVVSSINRCYYCLTAHGAAVRQLSGDPILGEQMVMNYRAARLDPRRRAMLD
FAAKLTERPHEVEEEDRAALRKVGFSERDIWDIGAVVGFFNMSNRIASATDMRPNEEYHV
QARTPKG