Protein Info for GFF3551 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 326 (26 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 332 (321 residues), 109.5 bits, see alignment E=9.1e-36 amino acids 250 to 397 (148 residues), 42.7 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 79% identical to YDIM_ECOLI: Inner membrane transport protein YdiM (ydiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to stm:STM1361)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF3551 Putative transport system permease protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKNRYFPTAVGLYFNYFVHGMGVILMSLNMSSLEQQWHTSAAGVSIVISSLGIGRLSVLL
IAGMLSDRFGRRPFIILGTTCYLIFFIGILYAQTIFVAYACGFLAGMANSFLDAGTYPSL
MEAFPRSPSTANILIKAFVSGGQFLLPIIISLLVWANMWFGWSFLLAGAIMLINALFLLR
CPFPPYPGRILKPKISQAPVTGVHHCSLIDLISYTLYGYISMATFYLISQWLAQYGQFVA
GMSYTQSIKLLSIYTCGSLLCVFITAPLVRKTIRSTTLLMFYTFISFIALLTVCLHPQTY
IVMIFAFVIGFSSAGGVVQIGLTLMASRFPQEKGKATGIYYSAGSIATFTIPLITARISE
MSIAHIMWFDTGIAAVGFLLALFIGYRSRAESQHHAEAASTAQ