Protein Info for GFF355 in Xanthobacter sp. DMC5

Annotation: Riboflavin transport system permease protein RibX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 245 (170 residues), 94.6 bits, see alignment E=3.3e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 93% identity to xau:Xaut_3758)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF355 Riboflavin transport system permease protein RibX (Xanthobacter sp. DMC5)
MMKKLSVENLAPVYFTVALFVIWEAACRLFKIDTFILPAPTEIFAAMVKYWWPLLKNSFV
TLWTTMAGFAIAVVFGIALGVVVGWSRTIYRGLYPVMIGFNSVPKVAVVPILIMWFGIGE
VPAILTAFLISFFPIVVNVATGLATTEPELEDVLRALGASKLDIMRKVGIPRTGPYLFGA
LKVGITLAFVGAVVSETIGANAGVGHLMVQAGSNFQMPLVFAGLISLAIQGILMYAIFAV
FERRMVAWAFRSSQSAGG