Protein Info for GFF3547 in Xanthobacter sp. DMC5

Annotation: Inosine-5'-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF00478: IMPDH" amino acids 22 to 493 (472 residues), 526.5 bits, see alignment E=4.3e-162 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 22 to 475 (454 residues), 640.9 bits, see alignment E=5.8e-197 PF00571: CBS" amino acids 107 to 161 (55 residues), 45.7 bits, see alignment 1e-15 amino acids 168 to 225 (58 residues), 32 bits, see alignment 1.9e-11 PF03060: NMO" amino acids 229 to 392 (164 residues), 39.9 bits, see alignment E=5.2e-14

Best Hits

Swiss-Prot: 59% identical to IMDH_AQUAE: Inosine-5'-monophosphate dehydrogenase (guaB) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 91% identity to xau:Xaut_3123)

MetaCyc: 41% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF3547 Inosine-5'-monophosphate dehydrogenase (Xanthobacter sp. DMC5)
MTTPNGTAHSSAIDSRSRFREALTFDDVLLTPGASEVMPGQVEITTQLTKTISLNMPIIS
AAMDTVTESRLAIAMAQAGGIGVIHRNLSPEMQAEHVRQVKKYESGMVVNPVTIHPDQTL
SDALDLMKRYSISGIPVVERGTGGIAGRLVGILTNRDVRFARDPAQRVAELMTKDRLVTV
REGQVNQDEAKRLLHQYRIEKLLVVDSDDRCVGLITVKDIEKAVAYPSAAKDEQGRLRVA
AATTVGEDGFERTERLIDAGVDLVVVDTAHGHSRKVLDQVERIKKLSNRTQILAGNIATS
DGAKALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLTAVMDAVEAALATGTPVVADGGI
KFSGDLAKALAAGASAAMVGSLLAGTDESPGEVFLFQGRSYKSYRGMGSVGAMARGSADR
YFQAEVRDTLKLVPEGIEGQVAYKGPVGAVLHQLAGGLRAAMGYVGGSNLKEFRERARFV
RISSAGLRESHVHDVTITRESPNYPTSV