Protein Info for GFF3542 in Sphingobium sp. HT1-2

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details TIGR00360: ComEC/Rec2-related protein" amino acids 1 to 130 (130 residues), 48.7 bits, see alignment E=5.3e-17 PF03772: Competence" amino acids 1 to 199 (199 residues), 107 bits, see alignment E=5.8e-35

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 67% identity to sjp:SJA_C1-08450)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF3542 DNA internalization-related competence protein ComEC/Rec2 (Sphingobium sp. HT1-2)
VRSCIAALLVLGGLALGREAVTLRLVATGALVVLVFWPEALIGPSFQMSFAAVVALVALG
EHRRFKAFAMARDEPWPCKAGRTVAAMLMTGLAIELVLAPIALYHFHKAGLLGAVANLVA
IPLTTFVIMPLEALALGFDLVGLGAPFWWLTAKAIALLLAVAHGVAASPMAVMLAPAVPG
GLFAVILVGGLWCLLWRSRWRWLGLGPVAIGLIGIASLAPPDIVVTGDGRHVAVRTPAGT
MALLREGAGDYVRDVLSESAGYDGTLEAIAKMPQARCSTDLCAVTLPRGGRDWHLLVTRN
AMLVDRPILERDCAAADIVISDRGLPWWCRPRWMKIDRRLLSRTGGLSIGLESGKVHTVH
RPGDAHPWIVRRRPRTAGQL