Protein Info for PS417_18125 in Pseudomonas simiae WCS417

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 19 to 125 (107 residues), 74.4 bits, see alignment E=4.3e-25 PF00528: BPD_transp_1" amino acids 38 to 230 (193 residues), 86.3 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to pba:PSEBR_a2355)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U911 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PS417_18125 polar amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MNFNWDVFWQYLLQPSGVYLTGLWLTCLIAVSAMLLGCVLGLAAALLRLSKNPLLHLPVR
FYVWLMRGTPLLVQIVFLYTALAAGGIFRFEDIDLFGLVVPGNIQAAIIALGLNEGAYMA
EIIRAGIGAVDKGQYEAGRSLGMGFAKLMRRIVLPQAFRVIVPPLGNEFNVMLKNTTLVS
VIGVQELLLSTQMVTSATFRVFELYLVVAIYFLMLTTLWGFFQRWLEARFGQSDRPSAPP
PASSRMFGRSTLKLLRGR