Protein Info for GFF3539 in Sphingobium sp. HT1-2

Annotation: Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 4 to 150 (147 residues), 207.2 bits, E=5.1e-66
• PF01967: MoaC
  • amino acids 15 to 148 (134 residues), 184.6 bits, E=4.2e-59

Best Hits

Swiss-Prot: 64% identical to MOAC_ERYLH: Cyclic pyranopterin monophosphate synthase (moaC) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 82% identity to sch:Sphch_1740)

MetaCyc: 51% identical to MoaC monomer (Thermus thermophilus HB8)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Protein Sequence (161 amino acids)

>GFF3539 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Sphingobium sp. HT1-2)
MTGLTHLDEDGAARMVDVSAKAVTAREAVAAGRITMAADAAQAIAAGLVKKGDVLAVARV
AGIMAAKRTAELIPLCHPIPLSAVTIDFTLHDDGVTVTATARTAGQTGVEMEALTAATAA
LLTVYDMAKALDKGMIIGDVRLLAKRGGKSGDWTAPETPGR