Protein Info for GFF3537 in Sphingobium sp. HT1-2

Annotation: Anthranilate phosphoribosyltransferase (EC 2.4.2.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 10 to 328 (319 residues), 364.4 bits, see alignment E=3e-113 PF02885: Glycos_trans_3N" amino acids 10 to 60 (51 residues), 43.1 bits, see alignment 2.9e-15 PF00591: Glycos_transf_3" amino acids 70 to 319 (250 residues), 277.7 bits, see alignment E=1.1e-86

Best Hits

Swiss-Prot: 74% identical to TRPD_NOVAD: Anthranilate phosphoribosyltransferase (trpD) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 87% identity to sjp:SJA_C1-08390)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF3537 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) (Sphingobium sp. HT1-2)
MTLLPDPSAPLAADEAARAFDLLFDADLSDEAIAGFLVTMARRGETATEIAAAARAMRAR
MIPVDAPEGTIDVCGTGGDGHHTLNVSTAVSLVVAAAGVPVAKHGNRAASSKAGAADTLE
ALGLDLDRAAATAEATLKDLGICFLFAQNYHPALKRLGPIRRSIGERTIFNLMGPLANPA
NVRRQLVGIARPAYVPIYADALGQLGATHAMIVSGDEGLDELSLAGGNDIAEVTADGVVA
MRRLTAADLGLSTHPVTAIRGGDPAHNAAALRALLQGETGAYRDAVLLNAAAALVVADAA
HDFQEGVEQAAEAIDNGLANALLNCWIAYQ