Protein Info for GFF3536 in Sphingobium sp. HT1-2

Annotation: Chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 84 to 421 (338 residues), 223.8 bits, see alignment E=1.8e-70

Best Hits

KEGG orthology group: None (inferred from 71% identity to swi:Swit_4838)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>GFF3536 Chloride channel protein (Sphingobium sp. HT1-2)
MRRSWSTLFWSLAIRQRRRLRESEAAFILLAVLAGVAAGLITNLLQLLAHGIQELLYGVS
INRLSALGEIRHPWRLLGLPLGGLALVLMARLLRRRQRPLIDVVEANALHGGRIPMADNL
VIAGQTVLSNGAGASVGLEAAYAQMGGGVASLLGQWLKLRRNDLRTLVGAGAGAGVGAAF
GAPLAGAFYAFEIVIGHYTPAAIAPVVAAALSAAFVTRALGVEPWLIATTADRILGTADY
LLYVLLGLLCAGLGILIMRMVTFAELRVQGWTWPGRWRPVIGGLLLMPLAWLTPQTLSAG
HGALHLNLILLPDWTVLLMILCLKIAASVISLSFGFRGGLFFASLFLGSLAGQIFAQIVD
LVGIGWSLDPNDAALVGMAALSVAIVGGPMTLGLLMLETTHDFQLMGVVLTASLLSSAVT
REMFGYSFSTWRLHLRGSTIRSPRDIGWVMNLTAGRMMRRDWVSVPDTMSVGQFRALVPL
GSASKAIMIDGAGGYRGIVPTAAAYRPELAEDAPIAPLATMADISLRADADIRAILPLFD
KAAADELAVVDESGLVLGVLTEKHARRRYFEEIESSQRALFGEG