Protein Info for GFF3535 in Xanthobacter sp. DMC5

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 1 to 254 (254 residues), 193 bits, see alignment E=7e-61 TIGR03150: beta-ketoacyl-acyl-carrier-protein synthase II" amino acids 2 to 416 (415 residues), 609.5 bits, see alignment E=1.2e-187 PF02801: Ketoacyl-synt_C" amino acids 262 to 375 (114 residues), 118.4 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 76% identical to FABF_RHIME: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 91% identity to xau:Xaut_3133)

MetaCyc: 54% identical to beta-ketoacyl-ACP synthase (Arabidopsis thaliana col)
2.3.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179

Use Curated BLAST to search for 2.3.1.179

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>GFF3535 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Xanthobacter sp. DMC5)
MRRVVVTGLGMVTPLACGVEPTWRRLLAGESGVKAISHFEVSDLACKIAANIPRGDGSDG
TYNPDQWMEPKEQRKVDEFIVFAMAAATQALDDAGWHPTEYEDQIASGVLIGSGIGGIEG
IADASLLLKDRGPRRISPFFIPGRLINLAGGYVSIQHGLKGPNHAVVTACSTGAHAIGDA
GRLIALGDADVMVAGGTESPVNRLSIAGFAACKALCTAFNEDPIHASRPYDKDRDGFVMG
EGAGVVVLEELEHAKARGAKIYAELVGYGLSGDAFHITAPSLDGDGAYRCMSAALKRAGM
TADDIDYINAHGTSTMADEIELKAVERLLGNAAAKTAMSSTKSSIGHLLGAAGSVEAIFS
ILAIRDQIAPATLNLDNPSVETPIDLVPLTPKPRKIDAVLSNSFGFGGTNASLVFRRYAA