Protein Info for GFF3535 in Sphingobium sp. HT1-2

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 375 to 406 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 39 to 167 (129 residues), 94.9 bits, see alignment E=4.7e-31 amino acids 164 to 378 (215 residues), 103.3 bits, see alignment E=1.3e-33 PF01740: STAS" amino acids 419 to 505 (87 residues), 53.4 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 58% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 83% identity to nar:Saro_0374)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>GFF3535 Sulfate permease (Sphingobium sp. HT1-2)
MIIEQAPALAPCDLMWIFDMTQFFSRYRRQWFSDARTARHDIMAGIVVALALIPEAIGFS
IIAGVDPRVGLYASVAIAITIALIGGRPGMISAATAAVAVLVGPLVREHGVEYLFAATIL
MGVVQIIAGLLRLDLLMQFVSRSVITGFVNALAILIFMAQLPQLTNVGWQTYAMVLGGLA
IIYLFPRITKAVPAPLVAIALLSVLSIGLGLPVHTVGDMGRLPEGLPSLALPQVPLTWDT
LRIILPYSVTMAAVGLLESLLTAQIVDDLTDSDSDKQRECMGQGGANIVASLFGGMGGCA
MIGQSVINVTSGGRGRLSTFVAGAFLLFLLAVLGPWVGRIPMPALVAVMVMVSIGTFSWA
SIANLRRHPPTSSAVMLATVVVVVATRDLSLGVLTGLLLSGIFFAAKVQRMFAAERSEVD
GRATYRVTGQIFFASVDRFTRAFTGEESATHVLIDVSGAHFWDISGVGALDKIIARLRRE
GRMVEVVGYNRASADIVDRFALHDKTGVETGAVPH