Protein Info for GFF3534 in Xanthobacter sp. DMC5

Annotation: Endolytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details PF02618: YceG" amino acids 75 to 348 (274 residues), 284.4 bits, see alignment E=5.1e-89 TIGR00247: conserved hypothetical protein, YceG family" amino acids 175 to 348 (174 residues), 189 bits, see alignment E=6.4e-60

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 67% identity to azc:AZC_4316)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF3534 Endolytic murein transglycosylase (Xanthobacter sp. DMC5)
MPTGPARSSKQRKAPPRRPPPKPPKPSRSARHPAVTIGSGIFTFLLFVFVGVGLAGWYGQ
RAFTEPGPLTTEKVVNIPRGAGVRDMAEILEREGVVQSWVLFVAGQKIARPDASLKAGEY
VFKPGQSVASVIDTIASGKVVLHQVTIPEGLTSQQVVKRLMDNDLLTGTPAVPQEGTLLP
ETYRIHRGMTRDAVLQEMADAQKKLLATIWAKRAPDVPLKSPQELVTLASIVEKETGQAD
ERPKVAAVFVNRLTKKMRLQSDPTIIYGIVGGRGSLGRPISRTDIATATAYNTYAIDGLP
PGPICNPGKDALMAAANPPKTKDLFFVADGTGGHAFAETLADHNKNVARWRAIEQGAAPA
QSGQPPAAPAATPPAATPPAASGR