Protein Info for PS417_18100 in Pseudomonas simiae WCS417

Annotation: iron ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF01032: FecCD" amino acids 17 to 327 (311 residues), 284.3 bits, see alignment E=5.3e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 95% identity to pfs:PFLU4090)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecC (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEC1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PS417_18100 iron ABC transporter (Pseudomonas simiae WCS417)
MGRSLAAAGIVLLGAGLFWLSLYSWSPFTITATDAWNGLVHQGRVGGNMAYIVAQLRVPR
ALCAALVGACLGLAGALMQGITRNRLASPSLFGVTAGAALGLALFSTGLVALPFAGGALL
MTCLGGALAWITVFSLGGAWSPTTAQGRLVLAGVAVAALCAALTRLTVILVEAQAQSVLN
WLAGSLANAGAAQVQLLWPCTLIGGLWALWCAPRLNLINLGEDAARSLGVGIASLRLQVF
IASLLLVGASVCAVGPIGFVGLIAPNILRQFLGNDYRWLIPLSAALGAVIVLAADLLSRA
VAFPVETPAGVVTALIGAPFFLFLARRAL