Protein Info for PS417_18095 in Pseudomonas simiae WCS417

Annotation: iron-dicitrate transporter subunit FecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details PF01032: FecCD" amino acids 14 to 319 (306 residues), 299.4 bits, see alignment E=1.4e-93

Best Hits

Swiss-Prot: 38% identical to BTUC_PHOPR: Vitamin B12 import system permease protein BtuC (btuC) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 95% identity to pfs:PFLU4089)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ55 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PS417_18095 iron-dicitrate transporter subunit FecD (Pseudomonas simiae WCS417)
MTRPPLRLWLLLGLLLLATLISLSAGTVWLTPDAVLDRLLAHDALDFDVWNHRLPRSLIA
ILAGCAFGLAGAIVQGVIRNPLASPEILGVTQGAGLALTVAIISWPHMPIAWLPLVACLG
GAGGALLLALYNAGVSFSGVRFALSGVAIAVTLSSVTEFLILSHPLDINTALLALTGSLW
SRNWHHVALVLPFLVLIPVGLCLAKPLNLIALGDEAAHSLGTALGRTRWLAMACAVVLTS
LGVGVIGPIGFIGLVAPHMARRLVGGHHQYLLPAAMLTGALLLVLADTLGRTLIAPSEIP
AGVLTAVIGAPYFLWLLARFKG