Protein Info for GFF3532 in Xanthobacter sp. DMC5
Annotation: Guanylate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to KGUA_RHOPB: Guanylate kinase (gmk) from Rhodopseudomonas palustris (strain BisB18)
KEGG orthology group: K00942, guanylate kinase [EC: 2.7.4.8] (inferred from 90% identity to xau:Xaut_3136)Predicted SEED Role
"Guanylate kinase (EC 2.7.4.8)" in subsystem MLST or Purine conversions (EC 2.7.4.8)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
- guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
- superpathway of purine nucleotide salvage (11/14 steps found)
- purine deoxyribonucleosides salvage (4/6 steps found)
- dZTP biosynthesis (3/5 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.4.8
Use Curated BLAST to search for 2.7.4.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (231 amino acids)
>GFF3532 Guanylate kinase (Xanthobacter sp. DMC5) MPNSASSSVSSHFALPGWKPGSGVLARRGLMLVLSSPSGAGKTTLSRLLLKSDDRITMSV SVTTRAPRPGEEHGKDYFFVDRDTFQRMRDEGELLEHATVFENLYGTPRGAVEQALSAGR DVLFDIDWQGTQQLGESAQQDLVKVFILPPSAADLEQRLRSRAQDSEEVVHQRMAKASDE ISHYTEYDYIIINHDVEDSLAKLTAILQAERLKRRRLTGLSSFVKGLRDHL