Protein Info for GFF3532 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00190: Cupin_1
  • amino acids 63 to 137 (75 residues), 24.4 bits, E=2.9e-09
• PF07883: Cupin_2
  • amino acids 69 to 133 (65 residues), 66.1 bits, E=2.7e-22
• PF02311: AraC_binding
  • amino acids 78 to 127 (50 residues), 24 bits, E=4.2e-09

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

• GDP-mannose biosynthesis (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• D-mannose degradation I (1/2 steps found)
• D-mannose degradation II (1/2 steps found)
• mannitol degradation II (2/4 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• mannitol biosynthesis (1/3 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (5/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Protein Sequence (151 amino acids)

>GFF3532 hypothetical protein (Sphingobium sp. HT1-2)
MGASGMAGWDGRIVGAGMTILLLPLLLAAAPDAPITPIDKANAEHYVWGGSNDGWHLVKR
DEMSVIQERIVPGGAEVRHYHQRARQFFYVLSGELTLEAGGVTHVLKAGQGLEVPPGVPH
RAQNRSGASVDFLVNSTPKSHGDRVDAPAGK