Protein Info for GFF3531 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF00171: Aldedh" amino acids 14 to 460 (447 residues), 458.9 bits, see alignment E=8.6e-142

Best Hits

KEGG orthology group: None (inferred from 53% identity to swi:Swit_2065)

MetaCyc: 54% identical to aromatic aldehyde dehydrogenase (Sphingobium sp. SYK-6)
Vanillin dehydrogenase. [EC: 1.2.1.67]; Aryl-aldehyde dehydrogenase. [EC: 1.2.1.67, 1.2.1.29]; 1.2.1.29 [EC: 1.2.1.67, 1.2.1.29]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.29 or 1.2.1.3 or 1.2.1.67

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>GFF3531 hypothetical protein (Sphingobium sp. HT1-2)
MQLLIDGELVDGARAIDLVNPADGQVFAAAPCADAAQVERAVAAGQRAFAGWRALDFAER
GARIAALADALEGRAEDFAACLTQEQGKPLAEARGEIEGAVAALRYHAGLRLEPVVLKDS
ATERVVEQRHPLGVVAAIVPWNYPILLLALKLAPALIAGNVLIAKPAPTTPLTTLMLGAL
AADIFPAGVVQMLGDAGDVGPMLTAHSGIAHVSFTGSTATGRRVMAAVADTVKRFTLELG
GNDPAILLDDADVAAVAPILFDGAMGNAGQVCLGVKRIYAPRALMPALGAALVACAQRAV
VGDGRAAGTTIGPVQNRAQYARLVDLLAEVRAQGRVLHGGAPMEGDGYYIAPTIVTDLPD
EARLVQEEQFGPIIPLLAYDDEAELVRRVNDGPYGLGASVWTADAARGQAMAARIDSGLV
WVNRLFDLPFDVPIGGAKQSGIGRHQGLAGVEEFTQIRIVNAALD