Protein Info for PS417_18080 in Pseudomonas simiae WCS417

Annotation: general secretion pathway protein GspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 164 to 187 (24 residues), see Phobius details amino acids 207 to 234 (28 residues), see Phobius details amino acids 365 to 391 (27 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 398 (395 residues), 449.2 bits, see alignment E=8.2e-139 PF00482: T2SSF" amino acids 65 to 188 (124 residues), 111 bits, see alignment E=1.9e-36 amino acids 269 to 390 (122 residues), 85 bits, see alignment E=2.1e-28

Best Hits

Swiss-Prot: 51% identical to GSPF_XANCP: Type II secretion system protein F (xpsF) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 87% identity to pfs:PFLU4079)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T971 at UniProt or InterPro

Protein Sequence (398 amino acids)

>PS417_18080 general secretion pathway protein GspF (Pseudomonas simiae WCS417)
MSLFKFRALDSQGVPQNGTLEAVDQVAAVAALHKRGLLLLQIEAAGSPLLRNPRGQLKGA
ALVSFTQQLATLLGAGQPLERSLSLLLKQPGQPQVRALIGRIRDHVKAGKPLSAALEEEG
GSFSPLYLSMVRAGEAGGALENTLRQLSDYLERSERLRGEVINALIYPAFLVVGVLGSLA
LLLAYVVPQFVPIFQDLGVPIPWITEVILALGEFLGAYGLLVLAGLIVSGGCWAARLRNP
AFREQYDRRLLGVRGIGPLLQRVEAARLTRTLGTLLSNGVALLQALVIARQVCTNRALQA
QVGSAAESVKGGGTLASAFGSQPLLPELALQMIEVGEQAGELDSMLLKVADIFDVEAKRG
IDRLLAALVPSLTVVMAVLVAVIMLAIMLPLMSLTSNI