Protein Info for GFF3526 in Xanthobacter sp. DMC5

Annotation: NAD-dependent malic enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00390: malic
  • amino acids 23 to 119 (97 residues), 77.2 bits, E=2.2e-25
  • amino acids 119 to 155 (37 residues), 23.4 bits, 7.2e-09
• PF03949: Malic_M
  • amino acids 169 to 361 (193 residues), 71.6 bits, E=1e-23
• PF01515: PTA_PTB
  • amino acids 433 to 753 (321 residues), 330.2 bits, E=2.3e-102

Best Hits

Swiss-Prot: 69% identical to MAO1_RHIME: NAD-dependent malic enzyme (dme) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00029, malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC: 1.1.1.40] (inferred from 92% identity to xau:Xaut_3143)

MetaCyc: 58% identical to malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) (Escherichia coli K-12 substr. MG1655)
RXN-16819 [EC: 4.1.1.101]; Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)). [EC: 4.1.1.101, 1.1.1.40]

Predicted SEED Role

"NAD-dependent malic enzyme (EC 1.1.1.38)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.38)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• glyoxylate cycle (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• methylaspartate cycle (14/19 steps found)
• L-malate degradation I (1/1 steps found)
• L-malate degradation II (1/1 steps found)
• chitin deacetylation (3/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (5/7 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• mixed acid fermentation (11/16 steps found)
• gluconeogenesis III (8/12 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• L-carnitine degradation II (1/3 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• methylgallate degradation (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (4/10 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• syringate degradation (3/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 4.1.1.101

Protein Sequence (759 amino acids)

>GFF3526 NAD-dependent malic enzyme (Xanthobacter sp. DMC5)
MASNISDDLRSGALYYHRTPRPGKLEIQATKPLGNQRDLALAYSPGVAAACEAIAADPLQ
AAELTIRSNLVGVVSNGTAVLGLGNIGPLAGKPVMEGKAVLFKKFAGIDVFDIEIDALTV
ERMVDVVSALEPTFGGINLEDIKAPECFEVEAQLRQRMKIPVFHDDQHGTAIIVAAAVRN
ALEIGNRKIEDLKIVTSGAGAAALACLGLLVTLGAKKENIWVTDIEGVVYDGRNTLMDPY
KEIYAQKTDKRSLDEVIEGAHIFLGLSAGGVLKPEMVKKMADKPLILALANPMPEIMPEA
AREARPDAMICTGRSDFPNQVNNVLCFPYIFRGALDVGATDINAEMKMAAVEALAALARE
TPSDVVARAYGGESRTFGADSLIPSPFDPRLILRIAPAVAKAAMDTGVATRPIADMDAYI
DRLDTFVFRSGFIMRPLFAKAKQSIKRVIYAEGEDERVLRAVQAVVEEGIARPIIVARPS
VVDTRLKRFGLSIQPGRDFDLINPEDDPRYRDYVRDYVEVAGRRGVTPDAARTLVRTHPT
VIAALAVHRGEADAMLCGIEGRFVRHLRQVRDIIGLAPGVKELAALSLLITSKGNFFICD
TQIQTEPTAADLAEMTVLAAAHVRRFGLEPRVALLSHSNFGSHETLSAKRVRSALSIIRE
RDPDLQVDGEMQADAALVEDIRKKSFPHSGLTGVANVLVMPDLDAADIAFNMIKVLGDAL
PVGPILMGTAKPAHILGPSVTTRGVVNMTAVAVAEAQTD