Protein Info for GFF3519 in Sphingobium sp. HT1-2

Annotation: General secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 28 to 659 (632 residues), 585.1 bits, see alignment E=8.3e-180 PF21305: type_II_gspD_N0" amino acids 28 to 98 (71 residues), 84.6 bits, see alignment E=5.1e-28 PF03958: Secretin_N" amino acids 122 to 180 (59 residues), 49.1 bits, see alignment 7.9e-17 amino acids 184 to 253 (70 residues), 34.3 bits, see alignment E=3.3e-12 amino acids 259 to 368 (110 residues), 41.1 bits, see alignment E=2.5e-14 PF00263: Secretin" amino acids 486 to 650 (165 residues), 169.9 bits, see alignment E=6e-54

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 80% identity to sjp:SJA_C1-23560)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (748 amino acids)

>GFF3519 General secretion pathway protein D (Sphingobium sp. HT1-2)
MTRHILKYSAALALVLAAPVPGHAQQTLNVRDADIRAFIQDAARVTGRTFIIDNRVQGKV
SVVTDRPLSKSEYFEIVLSTLRANGLVAVPAPGGAYRIQPADGAAGQPSAVGRAATRNSF
VTEVFRLRSVDAASVLETLRPLISKEGTVTANRAGNSIVVADYADNVARIRQVIARVDRD
TSSTQMVMLKNAGAREIATSLQALVQSGGGENGAPAAASVVPIDSSNAIAIRGDVNTVTR
LANMARELDRQAASGTEIRVYWLEHADAEKLLPVLQQLIGQSSSSPVTSSVPAAGASGGA
GGGAAPASAAAAPVAAGSSGSSGSGISTRGPAIVTRYEGANAIIVAANSDVQRMLGETIR
QIDTRREQVLVEAIIVEISDAAAKKLGVQFLLGSTSTGFAATNYSNASPSLITIAGAYGA
TKLGTTKTTVVAADGTTTTTETQTNSDLASSLTQAAVDSLASATGIVGGLGTQIGKNGIF
GAIINAVKSDTESNLLSTPSVMTLDNQKASILVGQQVPVTTGEALSQNFDNQFRTVQRQD
VGIKLEVKPQINTGGAIKLFLKQEVSSVAGPVSNSSSDLIINKREIETTVTVDDGEILAL
GGLLDDNERKTIERIPLLSDIPGIGELFKSRSKSRTKTNLMVFIRPTILRTKEDAQRLTQ
QRYGYVRGMQLQRSPDSEPTIDELVRDYMGAQPPIAPQPGDMTVEPQAGAAAPATSPAPG
QVQVIEPTVRQSSGVVRPVDLPPSGEKK