Protein Info for GFF3516 in Sphingobium sp. HT1-2

Annotation: General secretion pathway protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details PF07963: N_methyl" amino acids 44 to 68 (25 residues), 34.4 bits, see alignment (E = 1.1e-12) TIGR01710: type II secretion system protein G" amino acids 47 to 178 (132 residues), 171 bits, see alignment E=1.3e-54 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 47 to 69 (23 residues), 31.5 bits, see alignment (E = 1.1e-11) PF08334: T2SSG" amino acids 71 to 179 (109 residues), 131.7 bits, see alignment E=1.1e-42

Best Hits

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF3516 General secretion pathway protein G (Sphingobium sp. HT1-2)
MRKILSLRHSREGGNPSLNVERQAQAGEMDPRLRGDDEKEVGRSAEHGFTLVELMVVIVI
IGLLATIVAINVIPATDTARVEKAKADISTIEQALEQYRLDNLTYPAASDGLQALLNPPA
SLAQPQRYRRGGYIKKLPQDPWGRAYIYTVPGKKGAFDISSLGADGQPGGENENADIYSS
EM