Protein Info for GFF3513 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00165: HTH_AraC" amino acids 20 to 61 (42 residues), 27.7 bits, see alignment 3.4e-10 PF12833: HTH_18" amino acids 33 to 112 (80 residues), 67.8 bits, see alignment E=1.2e-22 PF06445: GyrI-like" amino acids 141 to 293 (153 residues), 103.7 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: K13652, AraC family transcriptional regulator (inferred from 66% identity to bja:blr4000)

Predicted SEED Role

"Bacterial transcription activator, effector binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF3513 HTH-type transcriptional activator RhaS (Xanthobacter sp. DMC5)
MTNAARERYRARMQRVLDHIDRHLDQDLGLEALSAVAAFSQAHFHRQFTATFGVTVHRYV
QLARLRRASYQLAFRAGASVTEVALDAGYDAPDAFARAFRQRFDQSPSAFRTSPEWQPWR
AACAPLTNARTKRMTTWTTGDIDIRDFPATPVAVMSHRGDPAAVYETVRRFIEWRRAAGL
GRSIAATFTVFHSDPRTTAPADFRLDLCAATHRPIQDNAQGVAAGLIPAGRCAVLRVIGH
SEDLEPAALFLYRDWLPDSGEEAGDFPLFCQRLSFFPDVPEHEAVTDLFLPLRSHPAG