Protein Info for GFF3510 in Variovorax sp. SCN45

Annotation: Multidrug efflux system, membrane fusion component => MexH of MexHI-OpmD system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 354 (311 residues), 265.6 bits, see alignment E=2.6e-83 PF16576: HlyD_D23" amino acids 64 to 269 (206 residues), 111.9 bits, see alignment E=5.5e-36 PF13437: HlyD_3" amino acids 166 to 266 (101 residues), 65.5 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_5697)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF3510 Multidrug efflux system, membrane fusion component => MexH of MexHI-OpmD system (Variovorax sp. SCN45)
MNKQSRVWLGASLATLVLGGAGFGLAMKLRPAHAEGGGMPPAKVAVATAQKTQVARFLSG
IGTLEANRQVEVPAEVEGRVAKILFTPGGEVRAGQLLVQLNDAPEQGDMERLTAQRANAK
ALLERTRRLLPQQAATQEQLEQAQAAFDQASGDLRRAQAVLEQKRIKAPFDGVLGIRRVN
LGQFVRAGDALVSLTDSRTLFANLTLPETALPVLKRNQQVALSVDAYPGRVFQGRLSTIE
PQIGSDTRTVRLQATIDNADGALTPGMFVNGKVALPARPDAITVPETAITYSTHGDSVFV
VRPAEKGDGFTAQQVFVKAGERQDGLVVIENGLAPGDKVVTSGQLRLYTGAAVMPTAKDT
LALAQEARP