Protein Info for GFF3505 in Sphingobium sp. HT1-2

Annotation: ABC transporter, fused permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 424 to 449 (26 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details amino acids 713 to 736 (24 residues), see Phobius details amino acids 766 to 789 (24 residues), see Phobius details amino acids 801 to 827 (27 residues), see Phobius details PF12704: MacB_PCD" amino acids 31 to 230 (200 residues), 38.6 bits, see alignment E=1.5e-13 PF02687: FtsX" amino acids 262 to 380 (119 residues), 37 bits, see alignment E=3.2e-13 amino acids 718 to 828 (111 residues), 33.8 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 66% identity to sch:Sphch_3411)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (838 amino acids)

>GFF3505 ABC transporter, fused permease protein (Sphingobium sp. HT1-2)
VTTLGWGASWRIARRDLHAGFRGLRLLFVCLFLGVMTLAAIGSLTSAITGEISVRGQMIL
GGDVEIAMTQRVMDARDQQAIARLGRTSETVRLRAMVHKSGGREAAPLLTELKGVDDAYP
LYGTLALQRGRYAPLTADHILISPALAERMAIGVGDALRYGTADFTVAAIIADEPDRVGE
GFTLGPVAIVSMDGLDRTGLIQPGSLYRAKYRLRLPAGADAQALRERLEKRYVEQGWEFK
DRERAAPGTNRFIENMGQFLSLIGLAALAIAGIGVSNGVASYLAIKRGALATFKVLGATS
ADIQRIYLLQIGVVAGLAILAGLVAGALSPPLLVWAAGDMLPVSPGFHLYPLPLVTSAAY
GLLIALIFTLPPLARARTEPVAAILRTLVDGRRRIDRRTLALVGGAIALLVAVVLLTART
PMFAAAMLGAIIATLLLLLAMGQGIRWLARRMPHARRPLLRLALANLHRPGAQTAALTVA
LGLALTLFVTLAAIQTSIQAEIGRTVPKQAPNLFILDMPAGAEAQFRALMAKRVPAAKLN
VVPILRGTVTGYSGKRVADLKEKPEGAWILRGERGVTYSATLPEGSEIVEGRWWSRDYVG
PPLVSLDADQAKALDIWVGDRITVSILGREIEARVASLRKINWDTMGFNYVMVFSPSTLA
SAPHSLTATISLPDKRQEQAVTSALLATFPGASVIEVGQVISQVSGLLDQMSGAILAAAS
VTVLAGVAVLIGAIAAGRQSRSYDSVVLKLLGATRGQILGAQALEYGVLAGLLALVALLL
GGAAAWYVVVQLFSFGWAPDWGVVLATLAGGAVLTLGIGLAGSIPLMSVRPARALRQL