Protein Info for PS417_17910 in Pseudomonas simiae WCS417

Annotation: APC family amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 17 to 67 (51 residues), see Phobius details amino acids 92 to 121 (30 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 297 to 323 (27 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 395 (26 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 17 to 433 (417 residues), 109.4 bits, see alignment E=2.2e-35 PF00324: AA_permease" amino acids 37 to 399 (363 residues), 71.8 bits, see alignment E=4.8e-24

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a2725)

Predicted SEED Role

"Cationic amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U167 at UniProt or InterPro

Protein Sequence (499 amino acids)

>PS417_17910 APC family amino acid permease (Pseudomonas simiae WCS417)
MSINDRLTAHLNRGTVGFPTALASTIGLIMASPVILTATMGFGIGGSAFALAMLIAVVMM
LAQATTFAEAASILPTTGSVYDYINCGMGRFFAITGTLSAYLIVHVFAGTAETILSGVMA
LVNFEHLNTLAESAGGSWLLGVGFVIVFGVLNAFGVSAFGRAEIILTFGMWTTLMVFGVL
GLIATPAVQLDGWFGESLVGTDLITVLSLVGMAMFMFVGCEFVTPLAPDLRQSAKVMPRA
MMLGLMGVATCMFIYGAAMKRQVENVVLDAASGVHLLDTPMAIPKFAEQVMGQIGPLWLG
IGFLFAGAATINTLMAGVPRILYGMAVDGALPKVFTYLHPRFKTPLLCILVAMLIPCLHA
LYLGGNTDNIMHLVLAAVCAWSFAYLLVTISVVSLRIRRPDLPRAYRSPWFPLPQIVSSI
GILLGMWFITPPGMNPADIYVPFGVMLGGTAAYALFWTLVVQKVNPFKPASVEEVLAKEF
SHQPEQADEGHGDFAAKTV