Protein Info for GFF3495 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 62.4 bits, see alignment E=4.4e-21 PF00486: Trans_reg_C" amino acids 161 to 235 (75 residues), 70.8 bits, see alignment E=7.9e-24

Best Hits

Swiss-Prot: 32% identical to ARCA_SHIFL: Aerobic respiration control protein ArcA (arcA) from Shigella flexneri

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 45% identity to xca:xccb100_0803)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF3495 hypothetical protein (Sphingobium sp. HT1-2)
MQNSHILLADDDAALLTSLSDYFGRYGFDVDTAANLADMRRLSEEGHYDLLIAEPMMPGQ
HTAGLLREFAFERRIPVIIHSRASSDIDRILGLEMGAEDYLTKPCNARELLARANAALRA
RRRQADAGTMATAPRDNSWVAFQGWRFDLTTRQLFDPSGGTISLSEGEYQLLRVFVANAR
QVLNRHQLLDQVYGASSDHYDRAIDVQLCRLRRKLSAGGLKGQTIRTVRNEGYIFVHPVT
AGNAAN