Protein Info for GFF3491 in Xanthobacter sp. DMC5

Annotation: Transcriptional regulatory protein PhoP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 86.5 bits, see alignment E=1.4e-28 PF00486: Trans_reg_C" amino acids 145 to 216 (72 residues), 88.4 bits, see alignment E=2.6e-29

Best Hits

Swiss-Prot: 45% identical to QSEB_ECOLI: Transcriptional regulatory protein QseB (qseB) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 94% identity to xau:Xaut_3176)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF3491 Transcriptional regulatory protein PhoP (Xanthobacter sp. DMC5)
VRLLVIEDDPELNRQLVEALGDAGYAVDRAYDGVEGQFLGETEPYDAIVLDIGLPKLDGI
SVLESWRRAGKTTPVLILTARDRWSDKVQGFDAGADDYVAKPFHMEEVLARLRALLRRAT
GHASSEMSCGPVRLDTRSGRVTVDGNPVKLTSHEYRLLSYLMHHAGRVVSRGELVEHLYD
QDFDRDSNTIEVFVGRLRKKLDCDVIQTVRGLGYLLAAPEEPR